SHROOM2 antibody (Middle Region)

Catalog No. ABIN633652

This Rabbit Polyclonal antibody specifically detects SHROOM2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SHROOM2 antibody (Middle Region) (ABIN633652)

Target: SHROOM2 (Shroom Family Member 2 (SHROOM2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SHROOM2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SHROOM2 Antibody

Binding Specificity: Middle Region

Specificity: SHROOM2 antibody was raised against the middle region of SHROOM2

Purification: Affinity purified

Immunogen: SHROOM2 antibody was raised using the middle region of SHROOM2 corresponding to a region with amino acids CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SHROOM2 Blocking Peptide, (ABIN937210), is also available for use as a blocking control in assays to test for specificity of this SHROOM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHROOM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SHROOM2

Target: SHROOM2 (Shroom Family Member 2 (SHROOM2))

Alternative Name: SHROOM2

Background: SHROOM2 shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.

Molecular Weight: 176 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Asymmetric Protein Localization