Serotonin Receptor 3B antibody

Catalog No. ABIN633653

Product Details anti-Serotonin Receptor 3B Antibody

Target: Serotonin Receptor 3B (HTR3B)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Serotonin Receptor 3B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: Serotonin receptor 3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Serotonin receptor 3B Blocking Peptide , catalog no. 33R-7215, is also available for use as a blocking control in assays to test for specificity of this Serotonin receptor 3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HTR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Serotonin Receptor 3B

Target: Serotonin Receptor 3B (HTR3B)

Alternative Name: Serotonin Receptor 3B (HTR3B Products)

Synonyms: HTR3B antibody, 5-HT3B antibody, 5-hydroxytryptamine receptor 3B antibody, 5-hydroxytryptamine (serotonin) receptor 3B antibody, HTR3B antibody, Htr3b antibody

Background: The product of HTR3B belongs to the ligand-gated ion channel receptor superfamily. HTR3B encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Synaptic Membrane