BTBD10 antibody

Catalog No. ABIN633657

Product Details anti-BTBD10 Antibody

Target: BTBD10 (BTB (POZ) Domain Containing 10 (BTBD10))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BTBD10 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BTBD10 Blocking Peptide, catalog no. 33R-1218, is also available for use as a blocking control in assays to test for specificity of this BTBD10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTBD10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BTBD10

Target: BTBD10 (BTB (POZ) Domain Containing 10 (BTBD10))

Alternative Name: BTBD10 (BTBD10 Products)

Background: BTBD10 appears to behave as a suppressor of cell death including neuronal cell death related to amyotrophic lateral sclerosis and an enhancer of cell growth via its positive regulation of Akt phosphorylation.

Molecular Weight: 54 kDa (MW of target protein)