KCTD13 antibody (N-Term)

Catalog No. ABIN633662

The Rabbit Polyclonal anti-KCTD13 antibody has been validated for WB and IHC. It is suitable to detect KCTD13 in samples from Human and Dog.

Quick Overview for KCTD13 antibody (N-Term) (ABIN633662)

Target: KCTD13 (Potassium Channel Tetramerisation Domain Containing 13 (KCTD13))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD13 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-KCTD13 Antibody

Binding Specificity: N-Term

Specificity: KCTD13 antibody was raised against the N terminal of KCTD13

Purification: Affinity purified

Immunogen: KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD13 Blocking Peptide, (ABIN5614303), is also available for use as a blocking control in assays to test for specificity of this KCTD13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD13

Target: KCTD13 (Potassium Channel Tetramerisation Domain Containing 13 (KCTD13))

Alternative Name: KCTD13

Background: KCTD13 mRNA is expressed in 3T3-L1 adipocytes and THP-1 macrophages. It is suggested that this gene provides a link between cytokine activation and DNA replication in liver as well as in other tissues.

Molecular Weight: 36 kDa (MW of target protein)