KCTD4 antibody (N-Term)

Catalog No. ABIN633664

This Rabbit Polyclonal antibody specifically detects KCTD4 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for KCTD4 antibody (N-Term) (ABIN633664)

Target: KCTD4 (BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KCTD4 Antibody

Binding Specificity: N-Term

Specificity: KCTD4 antibody was raised against the N terminal of KCTD4

Purification: Affinity purified

Immunogen: KCTD4 antibody was raised using the N terminal of KCTD4 corresponding to a region with amino acids MTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD4 Blocking Peptide, (ABIN5614308), is also available for use as a blocking control in assays to test for specificity of this KCTD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD4

Target: KCTD4 (BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4))

Alternative Name: KCTD4

Background: KCTD4 contains 1 BTB (POZ) domain. The exact function of KCTD4 remains unknown.

Molecular Weight: 30 kDa (MW of target protein)