KCNIP2 antibody (N-Term)

Catalog No. ABIN633673

This Rabbit Polyclonal antibody specifically detects KCNIP2 in WB. It exhibits reactivity toward Human, Rat and Dog.

Quick Overview for KCNIP2 antibody (N-Term) (ABIN633673)

Target: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Reactivity: Human, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNIP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KCNIP2 Antibody

Binding Specificity: N-Term

Specificity: KCNIP2 antibody was raised against the N terminal of KCNIP2

Purification: Affinity purified

Immunogen: KCNIP2 antibody was raised using the N terminal of KCNIP2 corresponding to a region with amino acids PEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNIP2 Blocking Peptide, (ABIN5614278), is also available for use as a blocking control in assays to test for specificity of this KCNIP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNIP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNIP2

Target: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Alternative Name: KCNIP2

Background: The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium.

Molecular Weight: 21 kDa (MW of target protein)