KCNG1 antibody (N-Term)
-
- Target See all KCNG1 Antibodies
- KCNG1 (Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNG1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNG1 antibody was raised against the N terminal of KCNG1
- Purification
- Affinity purified
- Immunogen
- KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD
- Top Product
- Discover our top product KCNG1 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNG1 Blocking Peptide, catalog no. 33R-6553, is also available for use as a blocking control in assays to test for specificity of this KCNG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNG1 (Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1))
- Alternative Name
- KCNG1 (KCNG1 Products)
- Background
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G.
- Molecular Weight
- 56 kDa (MW of target protein)
-