Bestrophin 3 antibody (N-Term)

Catalog No. ABIN633708

This anti-Bestrophin 3 antibody is a Rabbit Polyclonal antibody detecting Bestrophin 3 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for Bestrophin 3 antibody (N-Term) (ABIN633708)

Target: Bestrophin 3 (BEST3)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Bestrophin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Bestrophin 3 Antibody

Binding Specificity: N-Term

Specificity: BEST3 antibody was raised against the N terminal of BEST3

Purification: Affinity purified

Immunogen: BEST3 antibody was raised using the N terminal of BEST3 corresponding to a region with amino acids PLVYTQVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BEST3 Blocking Peptide, (ABIN5612312), is also available for use as a blocking control in assays to test for specificity of this BEST3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BEST3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Bestrophin 3

Target: Bestrophin 3 (BEST3)

Alternative Name: BEST3

Background: BEST3 belongs to the bestrophin family of anion channels, which includes BEST1, the gene mutant in vitelliform macular dystrophy, and 2 other BEST1-like genes, BEST2 and BEST4.

Molecular Weight: 51 kDa (MW of target protein)