TRPM4 antibody (N-Term)
-
- Target See all TRPM4 Antibodies
- TRPM4 (Transient Receptor Potential Cation Channel, Subfamily M, Member 4 (TRPM4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRPM4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRPM4 antibody was raised against the N terminal of TRPM4
- Purification
- Affinity purified
- Immunogen
- TRPM4 antibody was raised using the N terminal of TRPM4 corresponding to a region with amino acids ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI
- Top Product
- Discover our top product TRPM4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRPM4 Blocking Peptide, catalog no. 33R-2560, is also available for use as a blocking control in assays to test for specificity of this TRPM4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPM4 (Transient Receptor Potential Cation Channel, Subfamily M, Member 4 (TRPM4))
- Alternative Name
- TRPM4 (TRPM4 Products)
- Background
- TRPM4 is a calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca2+, it is impermeable to it. TRPM4 mediates transport of monovalent cations (Na+ > K+ > Cs+ > Li+), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca2+ oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production.
- Molecular Weight
- 134 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Production of Molecular Mediator of Immune Response
-