CHRNA3 antibody (N-Term)

Catalog No. ABIN633761

The Rabbit Polyclonal anti-CHRNA3 antibody has been validated for WB. It is suitable to detect CHRNA3 in samples from Human, Mouse and Rat.

Quick Overview for CHRNA3 antibody (N-Term) (ABIN633761)

Target: CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHRNA3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHRNA3 Antibody

Binding Specificity: N-Term

Specificity: CHRNA3 antibody was raised against the N terminal of CHRNA3

Purification: Affinity purified

Immunogen: CHRNA3 antibody was raised using the N terminal of CHRNA3 corresponding to a region with amino acids EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHRNA3 Blocking Peptide, (ABIN937844), is also available for use as a blocking control in assays to test for specificity of this CHRNA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHRNA3

Target: CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))

Alternative Name: CHRNA3

Background: The CHRNA3 subunit is expressed in the soma of the majority of pyramidal cells, with the most alpha 3 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Synaptic Membrane