CHRNA3 antibody (N-Term)
-
- Target See all CHRNA3 Antibodies
- CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHRNA3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CHRNA3 antibody was raised against the N terminal of CHRNA3
- Purification
- Affinity purified
- Immunogen
- CHRNA3 antibody was raised using the N terminal of CHRNA3 corresponding to a region with amino acids EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETN
- Top Product
- Discover our top product CHRNA3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHRNA3 Blocking Peptide, catalog no. 33R-2458, is also available for use as a blocking control in assays to test for specificity of this CHRNA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))
- Alternative Name
- CHRNA3 (CHRNA3 Products)
- Synonyms
- LNCR2 antibody, NACHRA3 antibody, PAOD2 antibody, (a)3 antibody, A730007P14Rik antibody, Acra-3 antibody, Acra3 antibody, cholinergic receptor nicotinic alpha 3 subunit antibody, cholinergic receptor, nicotinic, alpha polypeptide 3 antibody, CHRNA3 antibody, Chrna3 antibody
- Background
- The CHRNA3 subunit is expressed in the soma of the majority of pyramidal cells, with the most alpha 3 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-