SCN1B antibody (Middle Region)
-
- Target See all SCN1B Antibodies
- SCN1B (Sodium Channel, Voltage-Gated, Type I, beta (SCN1B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SCN1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SCN1 B antibody was raised against the middle region of SCN1
- Purification
- Affinity purified
- Immunogen
- SCN1 B antibody was raised using the middle region of SCN1 corresponding to a region with amino acids NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS
- Top Product
- Discover our top product SCN1B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SCN1B Blocking Peptide, catalog no. 33R-6928, is also available for use as a blocking control in assays to test for specificity of this SCN1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCN1B (Sodium Channel, Voltage-Gated, Type I, beta (SCN1B))
- Alternative Name
- SCN1B (SCN1B Products)
- Background
- Voltage-gated sodium channels are essential for the generation and propagation of action potentials in striated muscle and neuronal tissues. Biochemically, they consist of a large alpha subunit and 1 or 2 smaller beta subunits, such as SCN1B. The alpha subunit alone can exhibit all the functional attributes of a voltage-gated Na+ channel, but requires a beta-1 subunit for normal inactivation kinetics.
- Molecular Weight
- 25 kDa (MW of target protein)
-