KCNK5 antibody (C-Term)

Catalog No. ABIN633797

The Rabbit Polyclonal anti-KCNK5 antibody has been validated for WB. It is suitable to detect KCNK5 in samples from Human.

Quick Overview for KCNK5 antibody (C-Term) (ABIN633797)

Target: KCNK5 (Potassium Channel, Subfamily K, Member 5 (KCNK5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNK5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KCNK5 Antibody

Binding Specificity: C-Term

Specificity: KCNK5 antibody was raised against the C terminal of KCNK5

Purification: Affinity purified

Immunogen: KCNK5 antibody was raised using the C terminal of KCNK5 corresponding to a region with amino acids TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNK5 Blocking Peptide, (ABIN5614288), is also available for use as a blocking control in assays to test for specificity of this KCNK5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNK5

Target: KCNK5 (Potassium Channel, Subfamily K, Member 5 (KCNK5))

Alternative Name: KCNK5

Background: KCNK5 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK5 is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport.

Molecular Weight: 55 kDa (MW of target protein)