Nestin antibody (Middle Region)

Catalog No. ABIN633803

The Rabbit Polyclonal anti-Nestin antibody is suitable to detect Nestin in samples from Human. It has been validated for WB.

Quick Overview for Nestin antibody (Middle Region) (ABIN633803)

Target: Nestin (NES)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nestin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Nestin Antibody

Binding Specificity: Middle Region

Specificity: Nestin antibody was raised against the middle region of NES

Purification: Affinity purified

Immunogen: Nestin antibody was raised using the middle region of NES corresponding to a region with amino acids LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Nestin Blocking Peptide, (ABIN5614958), is also available for use as a blocking control in assays to test for specificity of this Nestin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NES antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Nestin

Target: Nestin (NES)

Alternative Name: Nestin

Background: Nestin is an intermediate filament protein. It is expressed predominantly in stem cells of the central nervous system in the neural tube.

Molecular Weight: 177 kDa (MW of target protein)