TMOD2 antibody

Catalog No. ABIN633812

The Rabbit Polyclonal anti-TMOD2 antibody is suitable to detect TMOD2 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for TMOD2 antibody (ABIN633812)

Target: TMOD2 (Tropomodulin 2 (TMOD2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMOD2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMOD2 Antibody

Purification: Affinity purified

Immunogen: Tropomodulin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDRED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tropomodulin 2 Blocking Peptide, (ABIN940226), is also available for use as a blocking control in assays to test for specificity of this Tropomodulin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMOD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMOD2

Target: TMOD2 (Tropomodulin 2 (TMOD2))

Alternative Name: Tropomodulin 2

Background: TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling