TMOD2 antibody
-
- Target See all TMOD2 Antibodies
- TMOD2 (Tropomodulin 2 (TMOD2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMOD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Tropomodulin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADI
- Top Product
- Discover our top product TMOD2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Tropomodulin 2 Blocking Peptide, catalog no. 33R-6513, is also available for use as a blocking control in assays to test for specificity of this Tropomodulin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMOD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMOD2 (Tropomodulin 2 (TMOD2))
- Alternative Name
- Tropomodulin 2 (TMOD2 Products)
- Synonyms
- zgc:86648 antibody, N-Tmod antibody, NTMOD antibody, N-TMOD antibody, tropomodulin 2 antibody, tmod2 antibody, Tmod2 antibody, TMOD2 antibody
- Background
- TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling
-