JARID2 antibody (N-Term)
-
- Target See all JARID2 Antibodies
- JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This JARID2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- JARID2 antibody was raised against the N terminal of JARID2
- Purification
- Affinity purified
- Immunogen
- JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ
- Top Product
- Discover our top product JARID2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
JARID2 Blocking Peptide, catalog no. 33R-9106, is also available for use as a blocking control in assays to test for specificity of this JARID2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JARID2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))
- Alternative Name
- JARID2 (JARID2 Products)
- Background
- This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation.
- Molecular Weight
- 139 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-