MPPED2 antibody (N-Term)

Catalog No. ABIN633824

The Rabbit Polyclonal anti-MPPED2 antibody has been validated for WB. It is suitable to detect MPPED2 in samples from Human and Rat.

Quick Overview for MPPED2 antibody (N-Term) (ABIN633824)

Target: MPPED2 (metallophosphoesterase Domain Containing 2 (MPPED2))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPPED2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MPPED2 Antibody

Binding Specificity: N-Term

Specificity: MPPED2 antibody was raised against the N terminal of MPPED2

Purification: Affinity purified

Immunogen: MPPED2 antibody was raised using the N terminal of MPPED2 corresponding to a region with amino acids RFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPPED2 Blocking Peptide, (ABIN5614832), is also available for use as a blocking control in assays to test for specificity of this MPPED2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPPED2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPPED2

Target: MPPED2 (metallophosphoesterase Domain Containing 2 (MPPED2))

Alternative Name: MPPED2

Background: The specific function of MPPED2 is not yet known.

Molecular Weight: 33 kDa (MW of target protein)