SH3G2 antibody (Middle Region)

Catalog No. ABIN633831

This anti-SH3G2 antibody is a Rabbit Polyclonal antibody detecting SH3G2 in WB. Suitable for Human and Mouse.

Quick Overview for SH3G2 antibody (Middle Region) (ABIN633831)

Target: SH3G2 (Endophilin-A1 (SH3G2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SH3G2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SH3G2 Antibody

Binding Specificity: Middle Region

Specificity: SH3 GL2 antibody was raised against the middle region of SH3 L2

Purification: Affinity purified

Immunogen: SH3 GL2 antibody was raised using the middle region of SH3 L2 corresponding to a region with amino acids PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SH3GL2 Blocking Peptide, (ABIN5616127), is also available for use as a blocking control in assays to test for specificity of this SH3GL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 L2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SH3G2

Target: SH3G2 (Endophilin-A1 (SH3G2))

Alternative Name: SH3GL2

Background: SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway, EGFR Downregulation