CHERP antibody (Middle Region)

Catalog No. ABIN633835

This Rabbit Polyclonal antibody specifically detects CHERP in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for CHERP antibody (Middle Region) (ABIN633835)

Target: CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHERP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHERP Antibody

Binding Specificity: Middle Region

Specificity: CHERP antibody was raised against the middle region of CHERP

Purification: Affinity purified

Immunogen: CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids SERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHERP Blocking Peptide, (ABIN5612846), is also available for use as a blocking control in assays to test for specificity of this CHERP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHERP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHERP

Target: CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))

Alternative Name: CHERP

Background: CHERP is involved in calcium homeostasis, growth and proliferation.

Molecular Weight: 104 kDa (MW of target protein)