C21orf62 antibody (Middle Region)
-
- Target See all C21orf62 products
- C21orf62 (Chromosome 21 Open Reading Frame 62 (C21orf62))
- Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C21orf62 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C21 ORF62 antibody was raised against the middle region of C21 rf62
- Purification
- Affinity purified
- Immunogen
- C21 ORF62 antibody was raised using the middle region of C21 rf62 corresponding to a region with amino acids STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWL
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C21ORF62 Blocking Peptide, catalog no. 33R-8879, is also available for use as a blocking control in assays to test for specificity of this C21ORF62 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF62 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C21orf62 (Chromosome 21 Open Reading Frame 62 (C21orf62))
- Alternative Name
- C21ORF62 (C21orf62 Products)
- Synonyms
- B37 antibody, PRED81 antibody, C21orf120 antibody, MGC88933 antibody, chromosome 21 open reading frame 62 antibody, chromosome 1 open reading frame, human C21orf62 antibody, chromosome 3 open reading frame, human C21orf62 antibody, C21orf62 antibody, C1H21ORF62 antibody, c21orf62 antibody, C3H21orf62 antibody
- Background
- The function of C21orf62 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 28 kDa (MW of target protein)
-