Glutathione Reductase antibody (N-Term)

Catalog No. ABIN633841

Product Details anti-Glutathione Reductase Antibody

Target: Glutathione Reductase (GSR)

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Glutathione Reductase antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GSR antibody was raised against the N terminal of GSR

Purification: Affinity purified

Immunogen: GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSR Blocking Peptide, catalog no. 33R-7387, is also available for use as a blocking control in assays to test for specificity of this GSR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Glutathione Reductase

Target: Glutathione Reductase (GSR)

Alternative Name: GSR (GSR Products)

Background: GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Cell RedoxHomeostasis