ECHDC2 antibody (Middle Region)

Catalog No. ABIN633843

The Rabbit Polyclonal anti-ECHDC2 antibody (ABIN633843) specifically detects ECHDC2 in WB. The antibody is reactive with Human, Rat and Mouse samples.

Quick Overview for ECHDC2 antibody (Middle Region) (ABIN633843)

Target: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ECHDC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ECHDC2 Antibody

Binding Specificity: Middle Region

Specificity: ECHDC2 antibody was raised against the middle region of ECHDC2

Purification: Affinity purified

Immunogen: ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ECHDC2 Blocking Peptide, (ABIN938504), is also available for use as a blocking control in assays to test for specificity of this ECHDC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ECHDC2

Target: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Alternative Name: ECHDC2

Background: ECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC2 remains unknown.

Molecular Weight: 28 kDa (MW of target protein)