UGCGL2 antibody (Middle Region)
-
- Target See all UGCGL2 (UGT2) Antibodies
- UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UGCGL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- UGCGL2 antibody was raised against the middle region of µgCGL2
- Purification
- Affinity purified
- Immunogen
- UGCGL2 antibody was raised using the middle region of µgCGL2 corresponding to a region with amino acids LCNNPKTKESKLKAAARIVPEWVEYDAEIRQLLDHLENKKQDTILTHDEL
- Top Product
- Discover our top product UGT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UGCGL2 Blocking Peptide, catalog no. 33R-4827, is also available for use as a blocking control in assays to test for specificity of this µgCGL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))
- Alternative Name
- UGCGL2 (UGT2 Products)
- Background
- UGCGL2 recognises glycoproteins with minor folding defects. UGCGL2 reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognised by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.
- Molecular Weight
- 172 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-