FUCA1 antibody (N-Term)

Catalog No. ABIN633859

This Rabbit Polyclonal antibody specifically detects FUCA1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for FUCA1 antibody (N-Term) (ABIN633859)

Target: FUCA1 (Fucosidase, alpha-L- 1, Tissue (FUCA1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FUCA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FUCA1 Antibody

Binding Specificity: N-Term

Specificity: FUCA1 antibody was raised against the N terminal of FUCA1

Purification: Affinity purified

Immunogen: FUCA1 antibody was raised using the N terminal of FUCA1 corresponding to a region with amino acids PSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FUCA1 Blocking Peptide, (ABIN5613657), is also available for use as a blocking control in assays to test for specificity of this FUCA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUCA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FUCA1

Target: FUCA1 (Fucosidase, alpha-L- 1, Tissue (FUCA1))

Alternative Name: FUCA1

Background: Alpha-L-fucosidase (EC 3.2.1.51) is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. At least 2 separate polymorphic alpha-L-fucosidases are recognised in man: that in tissues, FUCA1, which is deficient in fucosidosis, and that in plasma, FUCA2. Fucosidosis is an autosomal recessive lysosomal storage disease caused by defective alpha-L-fucosidase with accumulation of fucose in the tissues. Different phenotypes include clinical features such as neurologic deterioration, growth retardation, visceromegaly, and seizures in a severe early form, coarse facial features, angiokeratoma corporis diffusum, spasticity and delayed psychomotor development in a longer surviving form, and an unusual spondylometaphyseoepiphyseal dysplasia in yet another form.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process