MMP3 antibody

Catalog No. ABIN633867

Product Details anti-MMP3 Antibody

Target: MMP3 (Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MMP3 Blocking Peptide, catalog no. 33R-1118, is also available for use as a blocking control in assays to test for specificity of this MMP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MMP3

Target: MMP3 (Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3))

Alternative Name: MMP3 (MMP3 Products)

Background: MMP3 can degrade fibronectin, laminin, gelatins of type I, III, IV, and V, collagens III, IV, X, and IX, and cartilage proteoglycans. MMP3 activates procollagenase.Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases.

Molecular Weight: 43 kDa (MW of target protein)