FKBP2 antibody (N-Term)

Catalog No. ABIN633871

This Rabbit Polyclonal antibody specifically detects FKBP2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for FKBP2 antibody (N-Term) (ABIN633871)

Target: FKBP2 (FK506 Binding Protein 2, 13kDa (FKBP2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FKBP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FKBP2 Antibody

Binding Specificity: N-Term

Specificity: FKBP2 antibody was raised against the N terminal of FKBP2

Purification: Affinity purified

Immunogen: FKBP2 antibody was raised using the N terminal of FKBP2 corresponding to a region with amino acids RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FKBP2 Blocking Peptide, (ABIN5613595), is also available for use as a blocking control in assays to test for specificity of this FKBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FKBP2

Target: FKBP2 (FK506 Binding Protein 2, 13kDa (FKBP2))

Alternative Name: FKBP2

Background: FKBP2 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Molecular Weight: 16 kDa (MW of target protein)