ATPase Inhibitory Factor 1 antibody (N-Term)

Catalog No. ABIN633876

This anti-ATPase Inhibitory Factor 1 antibody is a Rabbit Polyclonal antibody detecting ATPase Inhibitory Factor 1 in WB. Suitable for Human.

Quick Overview for ATPase Inhibitory Factor 1 antibody (N-Term) (ABIN633876)

Target: ATPase Inhibitory Factor 1 (ATPIF1)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATPase Inhibitory Factor 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ATPase Inhibitory Factor 1 Antibody

Binding Specificity: N-Term

Specificity: ATPIF1 antibody was raised against the N terminal of ATPIF1

Purification: Affinity purified

Immunogen: ATPIF1 antibody was raised using the N terminal of ATPIF1 corresponding to a region with amino acids GSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIER

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATPIF1 Blocking Peptide, (ABIN938953), is also available for use as a blocking control in assays to test for specificity of this ATPIF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATPIF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATPase Inhibitory Factor 1

Target: ATPase Inhibitory Factor 1 (ATPIF1)

Alternative Name: ATPIF1

Background: This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.

Molecular Weight: 10 kDa (MW of target protein)