CRISP1 antibody (N-Term)

Catalog No. ABIN633879

This anti-CRISP1 antibody is a Rabbit Polyclonal antibody detecting CRISP1 in WB. Suitable for Human.

Quick Overview for CRISP1 antibody (N-Term) (ABIN633879)

Target: CRISP1 (Cysteine-Rich Secretory Protein 1 (CRISP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRISP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CRISP1 Antibody

Binding Specificity: N-Term

Specificity: CRISP1 antibody was raised against the N terminal of CRISP1

Purification: Affinity purified

Immunogen: CRISP1 antibody was raised using the N terminal of CRISP1 corresponding to a region with amino acids LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CRISP1 Blocking Peptide, (ABIN940479), is also available for use as a blocking control in assays to test for specificity of this CRISP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRISP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRISP1

Target: CRISP1 (Cysteine-Rich Secretory Protein 1 (CRISP1))

Alternative Name: CRISP1

Background: Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. CRISP1 is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface.

Molecular Weight: 27 kDa (MW of target protein)