FBLN4 antibody (Middle Region)

Catalog No. ABIN633884

Product Details anti-FBLN4 Antibody

Target: FBLN4 (Fibulin 4 (FBLN4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBLN4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EFEMP2 antibody was raised against the middle region of EFEMP2

Purification: Affinity purified

Immunogen: EFEMP2 antibody was raised using the middle region of EFEMP2 corresponding to a region with amino acids VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EFEMP2 Blocking Peptide, catalog no. 33R-9797, is also available for use as a blocking control in assays to test for specificity of this EFEMP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBLN4

Target: FBLN4 (Fibulin 4 (FBLN4))

Alternative Name: EFEMP2 (FBLN4 Products)

Synonyms: CB257 antibody, fbln4 antibody, fc56c09 antibody, id:ibd2923 antibody, sb:cb257 antibody, wu:fc56c09.x1 antibody, ARCL1B antibody, FBLN4 antibody, MBP1 antibody, UPH1 antibody, 0610011K11Rik antibody, Fbln4 antibody, FIBL-4 antibody, Fibulin-4 antibody, H411 antibody, EGF-containing fibulin-like extracellular matrix protein 2 antibody, EGF containing fibulin-like extracellular matrix protein 2b antibody, fibulin 4 antibody, EGF containing fibulin like extracellular matrix protein 2 antibody, epidermal growth factor-containing fibulin-like extracellular matrix protein 2 antibody, Efemp2 antibody, efemp2b antibody, fbln4 antibody, EFEMP2 antibody

Background: A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation and activation of complement.

Molecular Weight: 49 kDa (MW of target protein)