IGFBP7 antibody (C-Term)
-
- Target See all IGFBP7 Antibodies
- IGFBP7 (Insulin-Like Growth Factor Binding Protein 7 (IGFBP7))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IGFBP7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IGFBP7 antibody was raised against the C terminal of IGFBP7
- Purification
- Affinity purified
- Immunogen
- IGFBP7 antibody was raised using the C terminal of IGFBP7 corresponding to a region with amino acids RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH
- Top Product
- Discover our top product IGFBP7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IGFBP7 Blocking Peptide, catalog no. 33R-7926, is also available for use as a blocking control in assays to test for specificity of this IGFBP7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFBP7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGFBP7 (Insulin-Like Growth Factor Binding Protein 7 (IGFBP7))
- Alternative Name
- IGFBP7 (IGFBP7 Products)
- Background
- IGFBP7 contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 IGFBP N-terminal domain and 1 Kazal-like domain. It binds IGF-I and IGF-II with a relatively low affinity. IGFBP7 stimulates prostacyclin (PGI2) production.
- Molecular Weight
- 29 kDa (MW of target protein)
- Pathways
- Growth Factor Binding
-