IGFBP7 antibody (C-Term)

Catalog No. ABIN633886

Product Details anti-IGFBP7 Antibody

Target: IGFBP7 (Insulin-Like Growth Factor Binding Protein 7 (IGFBP7))

Binding Specificity: C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGFBP7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IGFBP7 antibody was raised against the C terminal of IGFBP7

Purification: Affinity purified

Immunogen: IGFBP7 antibody was raised using the C terminal of IGFBP7 corresponding to a region with amino acids RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IGFBP7 Blocking Peptide, catalog no. 33R-7926, is also available for use as a blocking control in assays to test for specificity of this IGFBP7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFBP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGFBP7

Target: IGFBP7 (Insulin-Like Growth Factor Binding Protein 7 (IGFBP7))

Alternative Name: IGFBP7 (IGFBP7 Products)

Background: IGFBP7 contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 IGFBP N-terminal domain and 1 Kazal-like domain. It binds IGF-I and IGF-II with a relatively low affinity. IGFBP7 stimulates prostacyclin (PGI2) production.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Growth Factor Binding