Endonuclease G antibody (Middle Region)
-
- Target See all Endonuclease G (ENDOG) Antibodies
- Endonuclease G (ENDOG)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Endonuclease G antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ENDOG antibody was raised against the middle region of ENDOG
- Purification
- Affinity purified
- Immunogen
- ENDOG antibody was raised using the middle region of ENDOG corresponding to a region with amino acids YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS
- Top Product
- Discover our top product ENDOG Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ENDOG Blocking Peptide, catalog no. 33R-10281, is also available for use as a blocking control in assays to test for specificity of this ENDOG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENDOG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Endonuclease G (ENDOG)
- Alternative Name
- ENDOG (ENDOG Products)
- Background
- ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Apoptosis
-