CYP2C9 antibody (C-Term)
-
- Target See all CYP2C9 Antibodies
- CYP2C9 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 9 (CYP2C9))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP2C9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP2 C9 antibody was raised against the C terminal of CYP2 9
- Purification
- Affinity purified
- Immunogen
- CYP2 C9 antibody was raised using the C terminal of CYP2 9 corresponding to a region with amino acids AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV
- Top Product
- Discover our top product CYP2C9 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP2C9 Blocking Peptide, catalog no. 33R-1211, is also available for use as a blocking control in assays to test for specificity of this CYP2C9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP2C9 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 9 (CYP2C9))
- Alternative Name
- CYP2C9 (CYP2C9 Products)
- Background
- CYP2C9 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by rifampin. The enzyme is known to metabolize many xenobiotics, including phenytoin, tolbutamide, ibuprofen and S-warfarin. Studies identifying individuals who are poor metabolizers of phenytoin and tolbutamide suggest that CYP2C9 gene is polymorphic.
- Molecular Weight
- 55 kDa (MW of target protein)
-