PYCR1 antibody (Middle Region)

Catalog No. ABIN633902

The Rabbit Polyclonal anti-PYCR1 antibody is suitable to detect PYCR1 in samples from Human and Rat. It has been validated for WB.

Quick Overview for PYCR1 antibody (Middle Region) (ABIN633902)

Target: PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PYCR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PYCR1 Antibody

Binding Specificity: Middle Region

Specificity: PYCR1 antibody was raised against the middle region of PYCR1

Purification: Affinity purified

Immunogen: PYCR1 antibody was raised using the middle region of PYCR1 corresponding to a region with amino acids KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PYCR1 Blocking Peptide, (ABIN939945), is also available for use as a blocking control in assays to test for specificity of this PYCR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PYCR1

Target: PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))

Alternative Name: PYCR1

Background: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types.

Molecular Weight: 33 kDa (MW of target protein)