BCKDHA antibody (N-Term)

Catalog No. ABIN633903

This anti-BCKDHA antibody is a Rabbit Polyclonal antibody detecting BCKDHA in WB. Suitable for Human, Mouse and Rat.

Quick Overview for BCKDHA antibody (N-Term) (ABIN633903)

Target: BCKDHA (Branched Chain Keto Acid Dehydrogenase E1, alpha Polypeptide (BCKDHA))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BCKDHA antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BCKDHA Antibody

Binding Specificity: N-Term

Specificity: BCKDHA antibody was raised against the N terminal of BCKDHA

Purification: Affinity purified

Immunogen: BCKDHA antibody was raised using the N terminal of BCKDHA corresponding to a region with amino acids NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BCKDHA Blocking Peptide, (ABIN5612294), is also available for use as a blocking control in assays to test for specificity of this BCKDHA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCKDHA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BCKDHA

Target: BCKDHA (Branched Chain Keto Acid Dehydrogenase E1, alpha Polypeptide (BCKDHA))

Alternative Name: BCKDHA

Background: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).

Molecular Weight: 50 kDa (MW of target protein)