CPE antibody (N-Term)

Catalog No. ABIN633904

This Rabbit Polyclonal antibody specifically detects CPE in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for CPE antibody (N-Term) (ABIN633904)

Target: CPE (Carboxypeptidase E (CPE))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPE antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CPE Antibody

Binding Specificity: N-Term

Specificity: Carboxypeptidase E antibody was raised against the N terminal of CPE

Purification: Affinity purified

Immunogen: Carboxypeptidase E antibody was raised using the N terminal of CPE corresponding to a region with amino acids GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxypeptidase E Blocking Peptide, (ABIN938826), is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase E antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPE

Target: CPE (Carboxypeptidase E (CPE))

Alternative Name: Carboxypeptidase E

Background: CPE is a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteins.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Membrane