Tachykinin 3 antibody

Catalog No. ABIN633913

This Rabbit Polyclonal antibody specifically detects Tachykinin 3 in WB. It exhibits reactivity toward Human.

Quick Overview for Tachykinin 3 antibody (ABIN633913)

Target: Tachykinin 3 (TAC3)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tachykinin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Tachykinin 3 Antibody

Purification: Affinity purified

Immunogen: Tachykinin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tachykinin 3 Blocking Peptide, (ABIN5616493), is also available for use as a blocking control in assays to test for specificity of this Tachykinin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tachykinin 3

Target: Tachykinin 3 (TAC3)

Alternative Name: Tachykinin 3

Background: Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.

Molecular Weight: 13 kDa (MW of target protein)