-
- Target See all Tachykinin 3 (TAC3) Antibodies
- Tachykinin 3 (TAC3)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Tachykinin 3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Tachykinin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF
- Top Product
- Discover our top product TAC3 Primary Antibody
-
anti-Tachykinin 3 (TAC3) (AA 23-121) antibody
TAC3 Reactivity: Human WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Tachykinin 3 (TAC3) (AA 29-101) antibodyTAC3 Reactivity: Mouse WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Tachykinin 3 (TAC3) (AA 29-102) antibodyTAC3 Reactivity: Rat WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Tachykinin 3 (TAC3) (AA 81-90) antibodyTAC3 Reactivity: Rat ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Tachykinin 3 (TAC3) (AA 17-121) antibodyTAC3 Reactivity: Human WB, ELISA Host: Mouse Monoclonal 1B2 unconjugated
anti-Tachykinin 3 (TAC3) (AA 1-121) antibodyTAC3 Reactivity: Human WB, IF Host: Rabbit Polyclonal unconjugated
anti-Tachykinin 3 (TAC3) antibodyTAC3 Reactivity: Human, Rat, Mouse IF Host: Rabbit Polyclonal unconjugated
anti-Tachykinin 3 (TAC3) (AA 36-85) antibodyTAC3 Reactivity: Human, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-Tachykinin 3 (TAC3) antibodyTAC3 Reactivity: Human, Rat, Mouse WB, IF, IC Host: Rabbit Polyclonal unconjugated
anti-Tachykinin 3 (TAC3) (AA 54-83) antibodyTAC3 Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Tachykinin 3 Blocking Peptide, catalog no. 33R-8189, is also available for use as a blocking control in assays to test for specificity of this Tachykinin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tachykinin 3 (TAC3)
- Alternative Name
- Tachykinin 3 (TAC3 Products)
- Background
- Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
- Molecular Weight
- 13 kDa (MW of target protein)
-
You are here:
