LIPF antibody (N-Term)

Catalog No. ABIN633941

The Rabbit Polyclonal anti-LIPF antibody has been validated for WB. It is suitable to detect LIPF in samples from Human.

Quick Overview for LIPF antibody (N-Term) (ABIN633941)

Target: LIPF (Lipase, Gastric (LIPF))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIPF antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LIPF Antibody

Binding Specificity: N-Term

Specificity: Lipase antibody (Gastric) was raised against the N terminal of LIPF

Purification: Affinity purified

Immunogen: Lipase antibody (Gastric) was raised using the N terminal of LIPF corresponding to a region with amino acids ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Lipase Blocking Peptide (Gastric), (ABIN939549), is also available for use as a blocking control in assays to test for specificity of this Lipase antibody (Gastric)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIPF

Target: LIPF (Lipase, Gastric (LIPF))

Alternative Name: Gastric Lipase

Background: This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism.

Molecular Weight: 43 kDa (MW of target protein)