Plexin A4 antibody (Middle Region)

Catalog No. ABIN633960

This anti-Plexin A4 antibody is a Rabbit Polyclonal antibody detecting Plexin A4 in WB. Suitable for Human.

Quick Overview for Plexin A4 antibody (Middle Region) (ABIN633960)

Target: Plexin A4 (PLXNA4)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Plexin A4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Plexin A4 Antibody

Binding Specificity: Middle Region

Specificity: Plexin A4 antibody was raised against the middle region of PLXNA4

Purification: Affinity purified

Immunogen: Plexin A4 antibody was raised using the middle region of PLXNA4 corresponding to a region with amino acids TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Plexin A4 Blocking Peptide, (ABIN5615421), is also available for use as a blocking control in assays to test for specificity of this Plexin A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXNA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Plexin A4

Target: Plexin A4 (PLXNA4)

Alternative Name: Plexin A4

Background: This protein mediates semaphorin receptor activity.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Regulation of Cell Size