Calreticulin 3 antibody (N-Term)

Catalog No. ABIN633963

This anti-Calreticulin 3 antibody is a Rabbit Polyclonal antibody detecting Calreticulin 3 in WB. Suitable for Human.

Quick Overview for Calreticulin 3 antibody (N-Term) (ABIN633963)

Target: Calreticulin 3 (CALR3)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Calreticulin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Calreticulin 3 Antibody

Binding Specificity: N-Term

Specificity: Calreticulin 3 antibody was raised against the N terminal of CALR3

Purification: Affinity purified

Immunogen: Calreticulin 3 antibody was raised using the N terminal of CALR3 corresponding to a region with amino acids MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Calreticulin 3 Blocking Peptide, (ABIN5612590), is also available for use as a blocking control in assays to test for specificity of this Calreticulin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALR3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Calreticulin 3

Target: Calreticulin 3 (CALR3)

Alternative Name: Calreticulin 3

Background: Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Activation of Innate immune Response