P4HB antibody (C-Term)

Catalog No. ABIN633967

Product Details anti-P4HB Antibody

Target: P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This P4HB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: P4 HB antibody was raised against the C terminal of P4 B

Purification: Affinity purified

Immunogen: P4 HB antibody was raised using the C terminal of P4 B corresponding to a region with amino acids DRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDD

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

P4HB Blocking Peptide, catalog no. 33R-2152, is also available for use as a blocking control in assays to test for specificity of this P4HB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 B antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for P4HB

Target: P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))

Alternative Name: P4HB (P4HB Products)

Background: P4HB is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Cell RedoxHomeostasis, Lipid Metabolism