LCN6 antibody (Middle Region)

Catalog No. ABIN633968

The Rabbit Polyclonal anti-LCN6 antibody has been validated for WB. It is suitable to detect LCN6 in samples from Human.

Quick Overview for LCN6 antibody (Middle Region) (ABIN633968)

Target: LCN6 (Lipocalin 6 (LCN6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LCN6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LCN6 Antibody

Binding Specificity: Middle Region

Specificity: Lipocalin 6 antibody was raised against the middle region of LCN6

Purification: Affinity purified

Immunogen: Lipocalin 6 antibody was raised using the middle region of LCN6 corresponding to a region with amino acids LWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Lipocalin 6 Blocking Peptide, (ABIN5614470), is also available for use as a blocking control in assays to test for specificity of this Lipocalin 6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LCN6

Target: LCN6 (Lipocalin 6 (LCN6))

Alternative Name: Lipocalin 6

Background: LCN6 may play a role in male fertility.

Molecular Weight: 18 kDa (MW of target protein)