Nucleobindin 1 antibody (C-Term)

Catalog No. ABIN633980

The Rabbit Polyclonal anti-Nucleobindin 1 antibody has been validated for WB. It is suitable to detect Nucleobindin 1 in samples from Human.

Quick Overview for Nucleobindin 1 antibody (C-Term) (ABIN633980)

Target: Nucleobindin 1 (NUCB1)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nucleobindin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Nucleobindin 1 Antibody

Binding Specificity: C-Term

Specificity: Nucleobindin 1 antibody was raised against the C terminal of NUCB1

Purification: Affinity purified

Immunogen: Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Nucleobindin 1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Nucleobindin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUCB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Nucleobindin 1

Target: Nucleobindin 1 (NUCB1)

Alternative Name: Nucleobindin 1

Background: Nucleobindin, also known as calnuc, participates in Ca2+ storage in the Golgi, as well as in other biological processes that involve DNA-binding and protein-protein interactions.

Molecular Weight: 54 kDa (MW of target protein)