RDH11 antibody

Catalog No. ABIN633983

The Rabbit Polyclonal anti-RDH11 antibody has been validated for WB. It is suitable to detect RDH11 in samples from Human and Rat.

Quick Overview for RDH11 antibody (ABIN633983)

Target: RDH11 (Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RDH11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RDH11 Antibody

Purification: Affinity purified

Immunogen: RDH11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RDH11 Blocking Peptide, (ABIN5615819), is also available for use as a blocking control in assays to test for specificity of this RDH11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RDH11

Target: RDH11 (Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11))

Alternative Name: RDH11

Background: RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.

Molecular Weight: 35 kDa (MW of target protein)