Haptoglobin antibody (Middle Region)

Catalog No. ABIN633992

The Rabbit Polyclonal anti-Haptoglobin antibody is suitable to detect Haptoglobin in samples from Human. It has been validated for WB.

Quick Overview for Haptoglobin antibody (Middle Region) (ABIN633992)

Target: Haptoglobin (HP)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Haptoglobin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Haptoglobin Antibody

Binding Specificity: Middle Region

Specificity: Haptoglobin antibody was raised against the middle region of HP

Purification: Affinity purified

Immunogen: Haptoglobin antibody was raised using the middle region of HP corresponding to a region with amino acids NANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNE

Application Details

Application Notes: WB: 0.0125 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Haptoglobin Blocking Peptide, (ABIN5613926), is also available for use as a blocking control in assays to test for specificity of this Haptoglobin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Haptoglobin

Target: Haptoglobin (HP)

Alternative Name: Haptoglobin

Background: This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis