Haptoglobin antibody (Middle Region)
-
- Target See all Haptoglobin (HP) Antibodies
- Haptoglobin (HP)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Haptoglobin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Haptoglobin antibody was raised against the middle region of HP
- Purification
- Affinity purified
- Immunogen
- Haptoglobin antibody was raised using the middle region of HP corresponding to a region with amino acids NANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNE
- Top Product
- Discover our top product HP Primary Antibody
-
-
- Application Notes
-
WB: 0.0125 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Haptoglobin Blocking Peptide, catalog no. 33R-6640, is also available for use as a blocking control in assays to test for specificity of this Haptoglobin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Haptoglobin (HP)
- Alternative Name
- Haptoglobin (HP Products)
- Synonyms
- HP antibody, wu:fb64e01 antibody, BP antibody, HP2ALPHA2 antibody, HPA1S antibody, HP-1 antibody, HPR antibody, Zonulin antibody, haptoglobin antibody, haptoglobin-like antibody, HP antibody, hp antibody, Hp antibody, LOC479668 antibody, LOC101102413 antibody
- Background
- This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin.
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-