Chymotrypsin antibody (N-Term)

Catalog No. ABIN634009

This Rabbit Polyclonal antibody specifically detects Chymotrypsin in WB. It exhibits reactivity toward Human.

Quick Overview for Chymotrypsin antibody (N-Term) (ABIN634009)

Target: Chymotrypsin (CTRL)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Chymotrypsin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Chymotrypsin Antibody

Binding Specificity: N-Term

Specificity: Chymotrypsin-Like antibody was raised against the N terminal of CTRL

Purification: Affinity purified

Immunogen: Chymotrypsin-Like antibody was raised using the N terminal of CTRL corresponding to a region with amino acids SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Chymotrypsin-Like Blocking Peptide, (ABIN5612884), is also available for use as a blocking control in assays to test for specificity of this Chymotrypsin-Like antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Chymotrypsin

Target: Chymotrypsin (CTRL)

Alternative Name: Chymotrypsin-Like

Target Type: Chemical

Background: CTRL possesses serine-type endopeptidase activity.

Molecular Weight: 28 kDa (MW of target protein)