MFAP2 antibody (N-Term)

Catalog No. ABIN634025

The Rabbit Polyclonal anti-MFAP2 antibody has been validated for WB. It is suitable to detect MFAP2 in samples from Human, Rat and Mouse.

Quick Overview for MFAP2 antibody (N-Term) (ABIN634025)

Target: MFAP2 (Microfibrillar Associated Protein 2 (MFAP2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MFAP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MFAP2 Antibody

Binding Specificity: N-Term

Specificity: MFAP2 antibody was raised against the N terminal of MFAP2

Purification: Affinity purified

Immunogen: MFAP2 antibody was raised using the N terminal of MFAP2 corresponding to a region with amino acids MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MFAP2 Blocking Peptide, (ABIN5614735), is also available for use as a blocking control in assays to test for specificity of this MFAP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MFAP2

Target: MFAP2 (Microfibrillar Associated Protein 2 (MFAP2))

Alternative Name: MFAP2

Background: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases.

Molecular Weight: 19 kDa (MW of target protein)