OLFML1 antibody (N-Term)

Catalog No. ABIN634027

This Rabbit Polyclonal antibody specifically detects OLFML1 in WB. It exhibits reactivity toward Human.

Quick Overview for OLFML1 antibody (N-Term) (ABIN634027)

Target: OLFML1 (Olfactomedin-Like 1 (OLFML1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OLFML1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OLFML1 Antibody

Binding Specificity: N-Term

Specificity: OLFML1 antibody was raised against the N terminal of OLFML1

Purification: Affinity purified

Immunogen: OLFML1 antibody was raised using the N terminal of OLFML1 corresponding to a region with amino acids IYQRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OLFML1 Blocking Peptide, (ABIN939610), is also available for use as a blocking control in assays to test for specificity of this OLFML1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFML1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OLFML1

Target: OLFML1 (Olfactomedin-Like 1 (OLFML1))

Alternative Name: OLFML1

Background: The function of OLFML1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 46 kDa (MW of target protein)