LYPD4 antibody (N-Term)

Catalog No. ABIN634028

The Rabbit Polyclonal anti-LYPD4 antibody has been validated for WB. It is suitable to detect LYPD4 in samples from Human.

Quick Overview for LYPD4 antibody (N-Term) (ABIN634028)

Target: LYPD4 (LY6/PLAUR Domain Containing 4 (LYPD4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYPD4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LYPD4 Antibody

Binding Specificity: N-Term

Specificity: LYPD4 antibody was raised against the N terminal of LYPD4

Purification: Affinity purified

Immunogen: LYPD4 antibody was raised using the N terminal of LYPD4 corresponding to a region with amino acids MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYPD4 Blocking Peptide, (ABIN5614611), is also available for use as a blocking control in assays to test for specificity of this LYPD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LYPD4

Target: LYPD4 (LY6/PLAUR Domain Containing 4 (LYPD4))

Alternative Name: LYPD4

Background: The specific function of LYPD4 is not yet known.

Molecular Weight: 27 kDa (MW of target protein)