PAPPA2 antibody (N-Term)
-
- Target See all PAPPA2 Antibodies
- PAPPA2 (Pappalysin 2 (PAPPA2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PAPPA2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PAPPA2 antibody was raised against the N terminal of PAPPA2
- Purification
- Affinity purified
- Immunogen
- PAPPA2 antibody was raised using the N terminal of PAPPA2 corresponding to a region with amino acids PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESL
- Top Product
- Discover our top product PAPPA2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PAPPA2 Blocking Peptide, catalog no. 33R-7246, is also available for use as a blocking control in assays to test for specificity of this PAPPA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPPA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAPPA2 (Pappalysin 2 (PAPPA2))
- Alternative Name
- PAPPA2 (PAPPA2 Products)
- Synonyms
- PAPP-A2 antibody, PLAC3 antibody, Pappe antibody, PAPP-E antibody, PAPPE antibody, si:dkey-39f8.1 antibody, pappalysin 2 antibody, Pappa2 antibody, PAPPA2 antibody, pappa2 antibody
- Background
- PAPPA2 is a metalloproteinase which specifically cleaves IGFBP-5. It shows limited proteolysis toward IGFBP-3.
- Molecular Weight
- 92 kDa (MW of target protein)
-